Recombinant Human Ephrin type-A receptor 8 (EPHA8), partial Active
Catalog No : IGX-RP2155-50UG
300.10€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Ephrin type-A receptor 8 (EPHA8), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2155-50UG | ||
Supplier’s Catalog No | IGX-RP2155-50UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Mouse | ||
Cross reactivity | Mouse | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 10.3 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Ephrin type-A receptor 8;EEK; HEK3; KIAA1459;EPHA8;Tyrosine-protein kinase receptor EEK;hEK3;EK3;EPH-like kinase 3;EPH- and ELK-related kinase | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. With EFNA5 may regulate integrin-mediated cell adhesion and migration on fibronectin substrate but also neurite outgrowth. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth (By similarity). Sequence: ARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTT |
© 2020 Imugex All Rights Reserved