Recombinant Mouse Fibroblast growth factor 9 (Fgf9) Active
Catalog No : IGX-RP2183-50UG
354.20€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Mouse Fibroblast growth factor 9 (Fgf9) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2183-50UG | ||
| Supplier’s Catalog No | IGX-RP2183-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 19.7 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Fibroblast growth factor 9;FGF-9;Glia-activating factor;GAF;heparin-binding growth factor-9;HBGF-9;Fgf9;Fgf-9 | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Sequence: MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS | ||
Product Details
© 2020 Imugex All Rights Reserved