Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog (Havcr2), partial Active

Catalog No : IGX-RP2185-50UG
240.86€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog (Havcr2), partial Active
Catalog No IGX-RP2185-50UG
Supplier’s Catalog No IGX-RP2185-50UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 23.7 KDa
Storage Store at -20℃/-80℃.
Other names Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3
Grade Highly Purified
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand Sequence: RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR