Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Recombinant Human Platelet basic protein (PPBP), partial Active
Catalog No			IGX-RP2199-50UG
Supplier’s Catalog No			IGX-RP2199-50UG
Supplier			ImuGeX
Source antigen			Recombinant, expressed in E.Coli
Reactivity			Human
Cross reactivity			Human
Applications			Functional studies, Bioassays or User optimised
Molecular weight			7.4 KDa

Storage			Store at -20℃/-80℃.
Other names			Platelet Basic Protein; PBP; C-X-C Motif Chemokine 7; Leukocyte-Derived Growth Factor; LDGF; Macrophage-Derived Growth Factor; MDGFSmall-Inducible Cytokine B7; PPBP; CTAP3; CXCL7; SCYB7; TGB1; THBGB1
Grade			Highly Purified
Purity			>97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form			Lyophilized
Reactivity life			12 months, when stored accoring to instructions.
Note			For reserch purpose only, not for In Vivo use or as therapeutics.
Purity			>97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description			LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD