Recombinant Human C-C motif chemokine 3 (CCL3) Active
Catalog No : IGX-RP2200-50UG
383.82€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human C-C motif chemokine 3 (CCL3) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2200-50UG | ||
| Supplier’s Catalog No | IGX-RP2200-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 7.7 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | C-C Motif Chemokine 3; G0/G1 Switch Regulatory Protein 19-1; Macrophage Inflammatory Protein 1-Alpha; MIP-1-Alpha; PAT 464.1; SIS-Beta; Small-Inducible Cytokine A3; Tonsillar Lymphocyte LD78 Alpha Protein; CCL3; G0S19-1; MIP1A; SCYA3 | ||
| Grade | Highly Purified | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA | ||
Product Details
© 2020 Imugex All Rights Reserved