Recombinant Human C-X-C motif chemokine 2 (CXCL2), partial Active
Catalog No : IGX-RP2201-50UG
458.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human C-X-C motif chemokine 2 (CXCL2), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2201-50UG | ||
Supplier’s Catalog No | IGX-RP2201-50UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 7.6 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | C-X-C Motif Chemokine 2; Growth-Regulated Protein Beta; Gro-Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2-Alpha; CXCL2; GRO2; GROB; MIP2A; SCYB2 | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Sequence: TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
© 2020 Imugex All Rights Reserved