Recombinant Human C-X-C motif chemokine 3 (CXCL3) Active
Catalog No : IGX-RP2202-50UG
354.20€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human C-X-C motif chemokine 3 (CXCL3) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2202-50UG | ||
| Supplier’s Catalog No | IGX-RP2202-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 7.5 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | C-X-C Motif Chemokine 3; GRO-Gamma (1-73); Growth-Regulated Protein Gamma; GRO-Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2-Beta; GRO-Gamma (5-73); CXCL3; GRO3; GROG; SCYB3 | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN | ||
Product Details
© 2020 Imugex All Rights Reserved