Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial Active
Catalog No : IGX-RP2203-50UG
329.73€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2203-50UG | ||
| Supplier’s Catalog No | IGX-RP2203-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 9.1 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | C-X-C Motif Chemokine 5; ENA-78 (1-78); Epithelial-Derived Neutrophil-Activating Protein 78; Neutrophil-Activating Peptide ENA-78; Small-Inducible Cytokine B5; ENA-78 (8-78); ENA-78 (9-78); CXCL5; ENA78; SCYB5 | ||
| Grade | Highly Purified | ||
| Purity | >90% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >90% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. Sequence: LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN | ||
Product Details
© 2020 Imugex All Rights Reserved