Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Recombinant Human Brain-derived neurotrophic factor (BDNF) Active
Catalog No			IGX-RP2209-50UG
Supplier’s Catalog No			IGX-RP2209-50UG
Supplier			ImuGeX
Source antigen			Recombinant, expressed in E.Coli
Reactivity			Human
Cross reactivity			Human
Applications			Functional studies, Bioassays or User optimised
Molecular weight			11.3 KDa

Storage			Store at -20℃/-80℃.
Other names			Brain-Derived Neurotrophic Factor; BDNF; Abrineurin
Grade			Highly Purified
Purity			>95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form			Lyophilized
Reactivity life			12 months, when stored accoring to instructions.
Note			For reserch purpose only, not for In Vivo use or as therapeutics.
Purity			>95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description			During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. Sequence: APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR