Recombinant Human Interleukin-1 beta (IL1B) Active
Catalog No : IGX-RP2225-50UG
354.20€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interleukin-1 beta (IL1B) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2225-50UG | ||
| Supplier’s Catalog No | IGX-RP2225-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 5.6 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interleukin-1 beta; Catabolin; IL1F2; IL1B. | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS | ||
Product Details
© 2020 Imugex All Rights Reserved