Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA),partialActive

Catalog No : IGX-RP2245-50UG
354.20€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA),partialActive
Catalog No IGX-RP2245-50UG
Supplier’s Catalog No IGX-RP2245-50UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 19.2 KDa
Storage Store at -20℃/-80℃.
Other names IL15RA&IL15;Interleukin-15; IL-15; IL15;IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha
Grade Highly Purified
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS