Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial Active
Catalog No : IGX-RP2252-50UG
354.20€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2252-50UG | ||
| Supplier’s Catalog No | IGX-RP2252-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in Yeast | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 109.6 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1 | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT | ||
Product Details
© 2020 Imugex All Rights Reserved