Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) Active
Catalog No : IGX-RP2432-50UG
458.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) Active | ||
---|---|---|---|
Catalog No | IGX-RP2432-50UG | ||
Supplier’s Catalog No | IGX-RP2432-50UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 8.9 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Granulocyte-macrophage colony-stimulating factor;Csf2;GM-CSF;Colony-stimulating factor;Csfgm | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
© 2020 Imugex All Rights Reserved