Recombinant Human Interleukin-15 receptor subunit alpha (IL-15R α), partial Active
Catalog No : IGX-RP2447-50UG
458.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interleukin-15 receptor subunit alpha (IL-15R α), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2447-50UG | ||
| Supplier’s Catalog No | IGX-RP2447-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.coli | ||
| Reactivity | Mouse | ||
| Cross reactivity | Mouse | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 11.7 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | CD215; IL15RA; CD215 antigen; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin 15 receptor; alpha; interleukin-15 receptor subunit alpha; MGC104179 | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK. Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT | ||
Product Details
© 2020 Imugex All Rights Reserved