Recombinant Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11), partial Active
Catalog No : IGX-RP2456-50UG
458.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2456-50UG | ||
Supplier’s Catalog No | IGX-RP2456-50UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.3 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Tumor necrosis factor ligand superfamily member 11;Tnfsf11;Osteoclast differentiation factor;ODF;Osteoprotegerin ligand;OPGL;Receptor activator of nuclear factor kappa-B ligand;RANKL;TNF-related activation-induced cytokine;TRANCE;CD254 | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts Sequence: QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
© 2020 Imugex All Rights Reserved