Recombinant Mouse Tumor necrosis factor (Tnf), partial Active

Catalog No : IGX-RP2458-50UG
354.20€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Mouse Tumor necrosis factor (Tnf), partial Active
Catalog No IGX-RP2458-50UG
Supplier’s Catalog No IGX-RP2458-50UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 21.8 KDa
Storage Store at -20℃/-80℃.
Other names Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2
Grade Highly Purified
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION Sequence: DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL