Recombinant Human Interleukin-3 (IL3), partial Active (GMP)
Catalog No : IGX-RP2507-5UG
176.46€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interleukin-3 (IL3), partial Active (GMP) | ||
|---|---|---|---|
| Catalog No | IGX-RP2507-5UG | ||
| Supplier’s Catalog No | IGX-RP2507-5UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in Mammalian cell | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 36.9 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Hematopoietic growth factor,Mast cell growth factor,MCGF,Multipotential colony-stimulating factor,P-cell-stimulating factor,IL-3 | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Liquid | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION Sequence: APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF | ||
Product Details
© 2020 Imugex All Rights Reserved