Recombinant Human Interleukin-1 alpha (IL1A) Active
Catalog No : IGX-RP2535-50UG
458.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interleukin-1 alpha (IL1A) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2535-50UG | ||
| Supplier’s Catalog No | IGX-RP2535-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 37.5 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interleukin-1 Alpha; IL-1 Alpha; Hematopoietin-1; IL1A; IL1F1 | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Liquid | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA | ||
Product Details
© 2020 Imugex All Rights Reserved