Recombinant Human Interleukin-15 (IL15), partial Active (GMP)
Catalog No : IGX-RP2547-5UG
113.34€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interleukin-15 (IL15), partial Active (GMP) | ||
---|---|---|---|
Catalog No | IGX-RP2547-5UG | ||
Supplier’s Catalog No | IGX-RP2547-5UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in Mammalian cell | ||
Reactivity | Mouse | ||
Cross reactivity | Mouse | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 47.3 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | IL-15 | ||
Grade | Highly Purified | ||
Purity | >90% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >90% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
© 2020 Imugex All Rights Reserved