Recombinant Human Arginase-1 (ARG1) Active
Catalog No : IGX-RP2555-50UG
542.25€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Arginase-1 (ARG1) Active | ||
---|---|---|---|
Catalog No | IGX-RP2555-50UG | ||
Supplier’s Catalog No | IGX-RP2555-50UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Arginase-1; Liver-type arginase; Type I arginase; ARG1 | ||
Grade | Highly Purified | ||
Purity | > 98 % by SDS-PAGE and HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | > 98 % by SDS-PAGE and HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys. Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
© 2020 Imugex All Rights Reserved