Recombinant Human C-X-C motif chemokine 14 (CXCL14) Active
Catalog No : IGX-RP2165-10UG
189.34€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human C-X-C motif chemokine 14 (CXCL14) Active | ||
---|---|---|---|
Catalog No | IGX-RP2165-10UG | ||
Supplier’s Catalog No | IGX-RP2165-10UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Rat | ||
Cross reactivity | Rat | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 7.9 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | C-X-C Motif Chemokine 14; Chemokine BRAKm MIP-2G; Small-Inducible Cytokine B14; CXCL14; MIP2G; NJAC; SCYB14 | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays. Sequence: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
© 2020 Imugex All Rights Reserved