Recombinant Human Lymphotoxin-alpha (LTA) Active
Catalog No : IGX-RP2177-10UG
189.34€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Lymphotoxin-alpha (LTA) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2177-10UG | ||
| Supplier’s Catalog No | IGX-RP2177-10UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Rat | ||
| Cross reactivity | Rat | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 10.5 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1 | ||
| Grade | Highly Purified | ||
| Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo. Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL | ||
Product Details
© 2020 Imugex All Rights Reserved