Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN) Active
Catalog No : IGX-RP2232-10UG
216.38€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN) Active | ||
---|---|---|---|
Catalog No | IGX-RP2232-10UG | ||
Supplier’s Catalog No | IGX-RP2232-10UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.2 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Interleukin-36 Receptor Antagonist Protein; FIL1 Delta; IL-1-Related Protein 3; IL-1RP3; Interleukin-1 HY1; IL-1HY1; Interleukin-1 Delta; IL-1 Delta; Interleukin-1 Family Member 5; IL-1F5; Interleukin-1 Receptor Antagonist Homolog 1; IL-1ra Homolog 1; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3 | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
© 2020 Imugex All Rights Reserved