Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial Active
Catalog No : IGX-RP2279-10UG
170.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2279-10UG | ||
Supplier’s Catalog No | IGX-RP2279-10UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 13.9 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Vesicle-associated membrane protein-associated protein B/C;VAMP-B/VAMP-C;VAMP-associated protein B/C;VAP-B/VAP-C | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation. Sequence: AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP |
© 2020 Imugex All Rights Reserved