Recombinant Human Malate dehydrogenase, cytoplasmic (MDH1) Active

Catalog No : IGX-RP2288-10UG
216.38€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Malate dehydrogenase, cytoplasmic (MDH1) Active
Catalog No IGX-RP2288-10UG
Supplier’s Catalog No IGX-RP2288-10UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 11.7 KDa
Storage Store at -20℃/-80℃.
Other names Malate Dehydrogenase Cytoplasmic; Cytosolic Malate Dehydrogenase; Diiodophenylpyruvate Reductase; MDH1; MDHA
Grade Highly Purified
Purity >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Sequence: SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA