Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial Active

Catalog No : IGX-RP2293-10UG
179.03€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial Active
Catalog No IGX-RP2293-10UG
Supplier’s Catalog No IGX-RP2293-10UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Mouse
Cross reactivity Mouse
Applications Functional studies, Bioassays or User optimised
Molecular weight 19.8 KDa
Storage Store at -20℃/-80℃.
Other names Pro-neuregulin-1;Neuregulin-1 beta 1;NRG1-beta 1;HRG1-beta 1; EGF;NRG1; GGF; HGL; HRGA; NDF; SMDF;
Grade Highly Purified
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE