Recombinant Human Fibroblast growth factor 7 (FGF7) Active

Catalog No : IGX-RP2434-10UG
216.38€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Fibroblast growth factor 7 (FGF7) Active
Catalog No IGX-RP2434-10UG
Supplier’s Catalog No IGX-RP2434-10UG
Supplier ImuGeX
Source antigen Recombinant, expressed in Mammalian cell
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 10.1 KDa
Storage Store at -20℃/-80℃.
Other names Fibroblast growth factor 7;FGF-7;Heparin-binding growth factor 7;HBGF-7;Keratinocyte growth factor;FGF7;KGF
Grade Highly Purified
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT