CGTase, Recombinant, Paenibacillus macerans, aa608-713, His-Tag (Cyclomaltodextrin Glucanotransferase)
Catalog No : USB-370561
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | CGTase, Recombinant, Paenibacillus macerans, aa608-713, His-Tag (Cyclomaltodextrin Glucanotransferase) | ||
|---|---|---|---|
| Catalog No | USB-370561 | ||
| Supplier’s Catalog No | 370561 | ||
| Supplier | US Biologicals | ||
| Source antigen | Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 13.45 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Description | Description: Recombinant protein corresponding to amino acids 608-713 of Paenibacillus macerans CGTase, fused to His-Tag at the N-terminus and expressed in yeast. Molecular Weight: ~13.45kD AA Sequence: VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN Enzyme Activity: Not determined. This product is recommended for use in applications that do not require a catalytically active form of the protein. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved