Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Biochemicals / Biochemicals

Product name			Biglycan, Recombinant, Human, aa38-368, His-SUMO-Tag, Myc-Tag (BGN)
Catalog No			USB-405881
Supplier’s Catalog No			405881
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			57.2

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol
Reactivity life			6 months
Note			For reserch purpose only
Description			May be involved in collagen fiber assembly. Source: Recombinant protein corresponding to aa38-368 from human Biglycan, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~57.2kD AA Sequence: DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.