EBI3, Recombinant, Human (Interleukin-27 Subunit beta, IL-27 Subunit beta, IL-27B, Epstein-Barr Virus-induced Gene 3 Protein, EBV-induced Gene 3 Protein, IL27B)
Catalog No : USB-E3440-50R
437.94€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | EBI3, Recombinant, Human (Interleukin-27 Subunit beta, IL-27 Subunit beta, IL-27B, Epstein-Barr Virus-induced Gene 3 Protein, EBV-induced Gene 3 Protein, IL27B) | ||
---|---|---|---|
Catalog No | USB-E3440-50R | ||
Supplier’s Catalog No | E3440-50R | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 23.3 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~90% (SDS-PAGE, HPLC) | ||
Form | Supplied as a lyophilized powder. Reconstitute in sterile dH2O to 0.1-0.5mg/ml. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE, HPLC) | ||
Description | Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI is a non-glycosylated polypeptide chain consisting of 209aa with a molecular weight of 23.3kD. Source: Recombinant corresponding to human EBI-3 expressed in E. coli. AA Sequence: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ QTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQL QVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQD LTDYGELSDWSLPATATMSLGK Molecular Weight: ~23.3kD Endoxotin Level: <0.01ng/ug Biological Activity: Assay data for human recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved