Hepatitis B Surface Antigen, preS1, Recombinant (HBsAg, HBV)
Catalog No : USB-208967
473.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Hepatitis B Surface Antigen, preS1, Recombinant (HBsAg, HBV) | ||
|---|---|---|---|
| Catalog No | USB-208967 | ||
| Supplier’s Catalog No | 208967 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 12.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~95% (10% PAGE, coomassie staining) | ||
| Form | Supplied as a lyophilized powder in 20mM PB, pH 7.4, 50mM sodium chloride. Reconstitute in sterile ddH2O or aqueous buffer, 0.1% BSA. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~95% (10% PAGE, coomassie staining) | ||
| Description | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119aa region called preS1. Source: Recombinant protein corresponding to Hepatitis B Surface Antigen preS1, a single non-glycosylated polypeptide chain containing 119aa, expressed in E. coli. Molecular Weight: ~12.6kD AA Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFG ANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTP PHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQP TPISPPLRDSHPQA Applications: Suitable for use in ELISA, Immunochromatography (capture and conjugate) and preparing monoclonal or polyclonal antibodies for HBsAg-preS1. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved