Hepatitis B Surface Antigen, preS2, Recombinant, (HBsAg, HBV)
Catalog No : USB-208968
473.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Hepatitis B Surface Antigen, preS2, Recombinant, (HBsAg, HBV) | ||
|---|---|---|---|
| Catalog No | USB-208968 | ||
| Supplier’s Catalog No | 208968 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 5.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~95%) | ||
| Form | Supplied as a lyophilized powder in 20mM PB, pH 7.4, 50mM sodium chloride. Reconstitute in sterile ddH2O or aqueous buffer, 0.1% BSA. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~95%) | ||
| Description | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55aa region called preS2. Source: Recombinant protein corresponding to Hepatitis B Surface Antigen preS2, a single non-glycosylated polypeptide chain containing 55aa, expressed in E. coli. Molecular Weight: ~5.7kD AA Sequence: MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTT ASPISSIFSRTGDP APN Applications: Suitable for use in ELISA, Western Blot and Immunochromatography (capture and conjugate). Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved