Zika Virus NS1, Strain Uganda MR 766, Recombinant, His-Tag
Catalog No : USB-348279
860.94€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Zika Virus NS1, Strain Uganda MR 766, Recombinant, His-Tag | ||
|---|---|---|---|
| Catalog No | USB-348279 | ||
| Supplier’s Catalog No | 348279 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, 293 human cells | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in DPBS, pH 7.4. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥90% (SDS-PAGE) | ||
| Description | Zika virus is an emerging disease that is spread by Aedes mosquitoes. The virus was first isolated in Central Africa, and has since been spread to South Asia and recently to South America. Outbreaks were reported in Micronesia in 2007 and in Brazil in 2015, confirming at least 13 autochthonous infections. Most recently a large Zika virus outbreak in Brazil has been linked to an increasing number of microcephaly cases, with the CDC now listing Zika Virus as a serious travel threat. Zika virus can cause mild fever, rash, myalgia, arthralgia and headaches, with one in four infected individuals being asymptomatic. Due to similar symptoms Zika virus infected individuals can easily be mis-diagnosed as a dengue infection and vice-versa. In addition, Zika virus has been implicated in causing microcephaly through transmission in utero. There is no vaccine or specific treatment available for Zika virus. Recombinant protein corresponding to Zika Virus NS1, strain Uganda MR 766, fused to 6X His-tag at C-terminal, expressed in 293 human cells. Purified from the supernatant of the mammalian cell expression system. Sequence: DVGCSVDFSKKETRCGTGVFIYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEEGICGISSVSRMENIMWKSVEGELNAILE ENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVVDGDTLKECPLEHRAWNSFLVEDHGF GVFHTSVWLKVREDYSLECDPAVIGTAVKGREAAHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGVEESD LIIPKSLAGPLSHHNTREGYRTQVKGPWHSEELEIRFEECPGTKVYVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPP LSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSHHHHHH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved