Enterotoxin Type G, Recombinant, Staphylococcus Aureus, aa26-258, His-SUMO-Tag (EntG)
Catalog No : USB-370602
578.18€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Enterotoxin Type G, Recombinant, Staphylococcus Aureus, aa26-258, His-SUMO-Tag (EntG) | ||
|---|---|---|---|
| Catalog No | USB-370602 | ||
| Supplier’s Catalog No | 370602 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 43.02 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa26-258 from Staphylococcus aureus entG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.02kD AA Sequence: QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved