Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-Tag (Mpt64)

Catalog No : USB-370658
578.18€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-Tag (Mpt64)
Catalog No USB-370658
Supplier’s Catalog No 370658
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa24-228 from full length Mycobacterium tuberculosis Immunogenic protein MPT64, fused to His-Tag at N-terminal, expressed in E. coli. AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.