PbpC, Recombinant, Bacillus Subtilis, aa21-240, His-Tag (Penicillin-binding Protein 3)
Catalog No : USB-370736
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | PbpC, Recombinant, Bacillus Subtilis, aa21-240, His-Tag (Penicillin-binding Protein 3) | ||
|---|---|---|---|
| Catalog No | USB-370736 | ||
| Supplier’s Catalog No | 370736 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 28.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Source: Partial recombinant protein corresponding to aa21-240 from Bacillus subtilis PbpC, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.3kD AA Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved