PbpC, Recombinant, Bacillus Subtilis, aa21-240, His-Tag (Penicillin-binding Protein 3)

Catalog No : USB-370736
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name PbpC, Recombinant, Bacillus Subtilis, aa21-240, His-Tag (Penicillin-binding Protein 3)
Catalog No USB-370736
Supplier’s Catalog No 370736
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 28.3
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Source: Partial recombinant protein corresponding to aa21-240 from Bacillus subtilis PbpC, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.3kD AA Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.