A27L, Recombinant, Variola Virus, aa1-110, His-Tag (14kD Fusion Protein)
Catalog No : USB-372095
501.16€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | A27L, Recombinant, Variola Virus, aa1-110, His-Tag (14kD Fusion Protein) | ||
|---|---|---|---|
| Catalog No | USB-372095 | ||
| Supplier’s Catalog No | 372095 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Source: Recombinant protein corresponding to aa1-110 from variola virus 14kDa Fusion Protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.5kD AA Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved