Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Botulinum Neurotoxin Type E, Recombinant, Clostridium Butyricum, aa2-422, His-Tag
Catalog No			USB-372476
Supplier’s Catalog No			372476
Supplier			US Biologicals
Source antigen			Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight			49.7

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase. Source: Recombinant protein corresponding to aa2-422 from Clostridium Butyricum Botulinum Neurotoxin Type E, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~49.7kD AA Sequence: PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIMKNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDPNYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEELSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQSILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.