EntC1, Recombinant, Staphylococcus Aureus, aa28-266, His-SUMO-Tag (Enterotoxin Type C-1)

Catalog No : USB-373190
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name EntC1, Recombinant, Staphylococcus Aureus, aa28-266, His-SUMO-Tag (Enterotoxin Type C-1)
Catalog No USB-373190
Supplier’s Catalog No 373190
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 43.5
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa28-266 from staphylococcus aureus Enterotoxin Type C-1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.5kD AA Sequence: ESQPDPTPDELHKASKFTGLMENMKVLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEGLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.