HasA, Recombinant, Serratia Marcescens, aa1-188, His-SUMO-Tag (Hemophore HasA)
Catalog No : USB-373589
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | HasA, Recombinant, Serratia Marcescens, aa1-188, His-SUMO-Tag (Hemophore HasA) | ||
|---|---|---|---|
| Catalog No | USB-373589 | ||
| Supplier’s Catalog No | 373589 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 35.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Can bind free heme and also acquire it from hemoglobin. Conveys heme from hemoglobin to the HasR receptor which releases it into the bacterium. HasR alone can take up heme but the synergy between HasA and HasR increases heme uptake 100-fold. Source: Recombinant protein corresponding to aa1-188 from serratia marcescens hasA, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~35.3kD AA Sequence: MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved