Hemagglutinin, Recombinant, Influenza A Virus, aa330-550, His-Tag (HA)
Catalog No : USB-373614
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Hemagglutinin, Recombinant, Influenza A Virus, aa330-550, His-Tag (HA) | ||
---|---|---|---|
Catalog No | USB-373614 | ||
Supplier’s Catalog No | 373614 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 27.3 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore. Source: Recombinant protein corresponding to aa330-550 from influenza A virus HA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.3kD AA Sequence: GIFGAIAGFIENGWEGMSSGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMVSCQKGNIRCNICI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved