Immunodeficiency Virus Type 2 Subtype A Protein Vpx, Recombinant, Human, aa1-113, His-Tag (Vpx)

Catalog No : USB-373846
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Immunodeficiency Virus Type 2 Subtype A Protein Vpx, Recombinant, Human, aa1-113, His-Tag (Vpx)
Catalog No USB-373846
Supplier’s Catalog No 373846
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 17.2
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription. Source: Recombinant protein corresponding to aa1-113 from human Immunodeficiency Virus Type 2 Subtype A Protein Vpx, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~17.2kD AA Sequence: MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.