Matrix Protein, Recombinant, Rabies Virus, aa1-202, His-Tag (M)
Catalog No : USB-374157
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Matrix Protein, Recombinant, Rabies Virus, aa1-202, His-Tag (M) | ||
---|---|---|---|
Catalog No | USB-374157 | ||
Supplier’s Catalog No | 374157 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 25.2 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons. Source: Recombinant protein corresponding to aa1-202 from rabies virus M, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.2kD AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved