ORF3, Recombinant, Potato Leafroll Virus, aa1-208, His-Tag (Major Capsid Protein)
Catalog No : USB-374559
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | ORF3, Recombinant, Potato Leafroll Virus, aa1-208, His-Tag (Major Capsid Protein) | ||
---|---|---|---|
Catalog No | USB-374559 | ||
Supplier’s Catalog No | 374559 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 27.2 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Major capsid protein. Source: Recombinant protein corresponding to aa1-208 from potato leafroll virus ORF3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD AA Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved