RelG, Recombinant, Mycobacterium Tuberculosis, aa1-87, His-SUMO-Tag (Toxin RelG)
Catalog No : USB-375031
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | RelG, Recombinant, Mycobacterium Tuberculosis, aa1-87, His-SUMO-Tag (Toxin RelG) | ||
|---|---|---|---|
| Catalog No | USB-375031 | ||
| Supplier’s Catalog No | 375031 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 26.2 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Toxic component of a toxin-antitoxin (TA) module. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides. Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB2 (shown only for M.smegmatis). Overexpression also increases the number of gentamicin-tolerant and levofloxacin-tolerant persister cells. Source: Recombinant protein corresponding to aa1-87 from mycobacterium tuberculosis relG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.2kD AA Sequence: MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved