SSB, Recombinant, Bacillus anthracis, aa1-172, His-SUMO-Tag (Single-stranded DNA-binding Protein)
Catalog No : USB-375418
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SSB, Recombinant, Bacillus anthracis, aa1-172, His-SUMO-Tag (Single-stranded DNA-binding Protein) | ||
|---|---|---|---|
| Catalog No | USB-375418 | ||
| Supplier’s Catalog No | 375418 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 34.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism. Source: Recombinant protein corresponding to aa1-172 from bacillus anthracis SSB, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.7kD AA Sequence: MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved