StxB2, Recombinant, Enterobacteria phage 933W, aa20-89, His-Tag (Shiga-like Toxin 2 Subunit B)
Catalog No : USB-375456
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | StxB2, Recombinant, Enterobacteria phage 933W, aa20-89, His-Tag (Shiga-like Toxin 2 Subunit B) | ||
|---|---|---|---|
| Catalog No | USB-375456 | ||
| Supplier’s Catalog No | 375456 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 9.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. Source: Recombinant protein corresponding to aa20-89 from enterobacteria phage 933W, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.8kD AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved