UL111A, Recombinant, Human, aa20-175, His-SUMO-Tag (Cytomegalovirus Viral Interleukin-10 Homolog)
Catalog No : USB-375767
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | UL111A, Recombinant, Human, aa20-175, His-SUMO-Tag (Cytomegalovirus Viral Interleukin-10 Homolog) | ||
|---|---|---|---|
| Catalog No | USB-375767 | ||
| Supplier’s Catalog No | 375767 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 34 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. Source: Recombinant protein corresponding to aa20-175 from human UL111A, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~34.0kD AA Sequence: SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved