UL99, Recombinant, Human, aa2-190, His-Tag (Cytomegalovirus Tegument Protein UL99)
Catalog No : USB-375774
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | UL99, Recombinant, Human, aa2-190, His-Tag (Cytomegalovirus Tegument Protein UL99) | ||
|---|---|---|---|
| Catalog No | USB-375774 | ||
| Supplier’s Catalog No | 375774 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 24.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery. Source: Recombinant protein corresponding to aa2-190 from human Cytomegalovirus Tegument Protein UL99, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD AA Sequence: GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved