Gamma-hemolysin Component B, Recombinant, Staphylococcus Aureus, aa26-325, His-tag (hlgB)

Catalog No : USB-405928
527.60€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Gamma-hemolysin Component B, Recombinant, Staphylococcus Aureus, aa26-325, His-tag (hlgB)
Catalog No USB-405928
Supplier’s Catalog No 405928
Supplier US Biologicals
Source antigen Recombinnt, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 36.1
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. Source: Recombinant protein corresponding to aa26-325 from staphylococcus aureus gamma-hemolysin component B, fused to His-tag at N-terminal, expressed in yeast. Molecular Weight: ~36.1kD AA Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.